Invitrogen™ Human FABP7 (aa 1-82) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90848	100 μL

Catalog No. RP90848 Supplier Invitrogen™ Supplier No. RP90848

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83034. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FABP7 was initially isolated from a human fetal brain cDNA library and whose mRNA was expressed in adult brain and muscle tissues at low levels. The protein encoded by this gene is a member of the fatty acid binding protein (FABPs) family, a group of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism. FABP7 is a downstream gene of the Pax6 transcription factor and has been suggested to be essential for the maintenance of neuroepithelial cells during early cortical development. More recently, FABP7 was found to be frequently expressed in melanomas. Down-regulation of FABP7 through RNAi expression could reduce in vitro cell proliferation and Matrigel invasion, suggesting that FABP7 may be a potential target for the development of diagnostic and therapeutic tools.

Specifications

• Accession Number: O15540
• Concentration: 2.5 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2173
• Name: Human FABP7 (aa 1-82) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: B FABP; BFABP; B-FABP; BLBP; brain lipid binding protein; brain lipid-binding protein; Brain-type fatty acid-binding protein; DKFZp547J2313; FABP 7; FABP7; FABPB; fatty acid binding protein 7; fatty acid binding protein 7, brain; fatty acid-binding protein 7; Fatty acid-binding protein, brain; fatty acid-binding protein, brain-like protein; hypothetical protein DKFZp547J2313; Mammary-derived growth inhibitor related; mammary-derived growth inhibitor-related; MRG; OTTHUMP00000017119; RP11-548E19.1
• Common Name: FABP7
• Gene Symbol: FABP7
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining