Invitrogen™ Human FALZ Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106184	100 μL

Catalog No. RP106184 Supplier Invitrogen™ Supplier No. RP106184

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83905. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BPTF (bromodomain and PHD domain transcription factor) is the largest subunit of the ATP-dependent chromatin-remodelling complex, NURF (nucleosome remodelling factor). NURF catalyses ATP-dependent nucleosome sliding and facilitates transcription. BPTF recognises histone H3 tails that are tri-methylated at K4, which marks the transcriptional start site of the vast majority of transcriptionally active genes. BPTF also exhibits some binding to H3 di-methylated at K4. BPTF plays a key role in the development of early mouse embryos, possibly through regulation of the Smad pathway of transcription factors. While BPTF is expressed in low levels in the adult brain and spinal cord, it is expressed in higher levels in the brain in neurodegenerative diseases. It is present in a subset of amyloid-containing plaques in the brains of patients suffering from Alzheimer's disease. Abundantly expressed in the fetal brain. Present throughout the gray and white matter of the developing spinal cord at 18-22 gestational weeks. Expressed at low levels in adult brain and spinal cord and reexpressed in neurodegenerative diseases (at protein level).Tissue specificity: Ubiquitously expressed, with highest levels in testis. Present in kidney, liver and brain. In the brain, highest levels are found in motor cortex (at protein level).

Specifications

• Accession Number: Q12830
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2186
• Name: Human FALZ Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 9430093H17Rik; BPTF; bromodomain and PHD domain transcription factor; bromodomain and PHD finger-containing transcription factor; bromodomain PHD finger transcription factor; FAC1; FALZ; fetal Alz-50 clone 1 protein; fetal Alz-50 reactive clone 1; fetal Alzheimer antigen; nucleosome remodeling factor, large subunit; nucleosome-remodeling factor subunit BPTF; NURF301
• Common Name: FALZ
• Gene Symbol: BPTF
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TTIASTGQTFQITGNPVTMAGKVITKLPLPANSKIVAVNVPATQGGIVQVHQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining