Invitrogen™ Human FAM114A1 (aa 381-453) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107611	100 μL

Catalog No. RP107611 Supplier Invitrogen™ Supplier No. RP107611

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66967. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May play a role in neuronal cell development.

Specifications

• Accession Number: Q8IWE2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 92689
• Name: Human FAM114A1 (aa 381-453) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1190001N04Rik; 9130005N14Rik; FAM114A1; family with sequence similarity 114 member A1; family with sequence similarity 114, member A1; nervous system overexpressed protein 20; nervous system over-expressed protein 20; Noxp20; Protein FAM114A1; Protein NOXP20; RGD1560201
• Common Name: FAM114A1
• Gene Symbol: FAM114A1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TPDKLNKAMKRAHDWVEEDQTVVSVDVAKVSEEETKKEEKEEKSQDPQEDKKEEKKTKTIEEVYMSSIESLAE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining