Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98829

Invitrogen™ Human FAM115C (aa 377-447) Control Fragment Recombinant Protein

Catalog No. RP98829
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98829 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98829 Supplier Invitrogen™ Supplier No. RP98829
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58530. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The FAM115C gene (Family with Sequence Similarity 115 Member C) is a relatively under-characterized gene located on chromosome 9q34.13. This gene encodes a protein that is part of the FAM115 family, which is involved in various cellular processes, including signal transduction, cellular growth, and maintenance. While detailed functional studies on FAM115C are limited, proteins in this family are often characterized by their involvement in cellular homeostasis and regulatory mechanisms. Research on FAM115C is nascent, but it is suggested to play a role in the central nervous system based on expression patterns in brain tissues.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number A6NFQ2
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 285966
Name Human FAM115C (aa 377-447) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias FAM115C; FAM139A; family with sequence similarity 115, member C; family with sequence similarity 139, member A; protein FAM115C; TCAF2; TRP channel-associated factor 2; TRPM8 channel associated factor 2; TRPM8 channel-associated factor 2
Common Name FAM115C
Gene Symbol TCAF2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AGFPGNIILNCFGLSILPQTLKAGCFPVPTPEMRSYHFRKALSQFQAILNHENGNLEKSCLAKLRVDGAAF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.