Invitrogen™ Human FAM120A (aa 468-548) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92880	100 μL

Catalog No. RP92880 Supplier Invitrogen™ Supplier No. RP92880

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54069. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May participate in mRNA transport in the cytoplasm. Critical component of the oxidative stress-induced survival signaling. Activates src family kinases and acts as a scaffolding protein enabling src family kinases to phosphorylate and activate PI3-kinase. Binds RNA and promotes the secretion of IGF-II. May play a pivotal role in the progression of scirrhous-type gastric cancer by supporting cancer cell survival in environments with various oxidative stresses. [UniProt].

Specifications

• Accession Number: Q9NZB2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 23196
• Name: Human FAM120A (aa 468-548) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: C9orf10; Constitutive coactivator of PPAR-gamma-like protein 1; DNAPTP1; DNAPTP5; Fam120a; family with sequence similarity 120, member A; family with sequence similarity 120A; Kiaa0183; Ossa; oxidative stess-associated Src activator; oxidative stress-associated Src activator; Protein FAM120A; RGD1306643
• Common Name: FAM120A
• Gene Symbol: Fam120a
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAEGKGSQMGTVQPIPCLLSMPTRNHMDITTPPL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining