Invitrogen™ Human FAM134B (aa 354-488) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90374	100 μL

Catalog No. RP90374 Supplier Invitrogen™ Supplier No. RP90374

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64943. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function remains unknown.

Specifications

• Accession Number: Q9H6L5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 54463
• Name: Human FAM134B (aa 354-488) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1810015C04Rik; AU015349; FAM134B; family with sequence similarity 134 member B; family with sequence similarity 134, member B; hypothetical protein FLJ20152; hypothetical protein LOC540068; JK1; JK-1; protein FAM134B; Protein FAM134B-like protein; reticulophagy receptor 1; reticulophagy receptor FAM134B; reticulophagy regulator 1; Retreg1
• Common Name: FAM134B
• Gene Symbol: RETREG1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ENGMGTNDEDELSLGLPTELKRKKEQLDSGHRPSKETQSAAGLTLPLNSDQTFHLMSNLAGDVITAAVTAAIKDQLEGVQQALSQAAPIPEEDTDTEEGDDFELLDQSELDQIESELGLTQDQEAEAQQNKKSSG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining