Invitrogen™ Human FAM213A (aa 33-131) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90168	100 μL

Catalog No. RP90168 Supplier Invitrogen™ Supplier No. RP90168

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52640. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in redox regulation of the cell (PubMed:26438880, PubMed:19951071). Acts as an antioxidant (PubMed:19951071, PubMed:26438880). Inhibits TNFSF11-induced NFKB1 and JUN activation and osteoclast differentiation (PubMed:19951071). May affect bone resorption and help to maintain bone mass (PubMed:19951071). Acts as a negative regulator of macrophage-mediated inflammation by inhibiting macrophage production of inflammatory cytokines, probably through suppression of the MAPK signaling pathway (PubMed:26438880). [UniProt].

Specifications

• Accession Number: Q9BRX8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 84293
• Name: Human FAM213A (aa 33-131) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: C10orf58; Fam213a; family with sequence similarity 213 member A; family with sequence similarity 213, member A; Pamm; peroxiredoxin (PRX)-like 2 activated in M-CSF stimulated monocytes; peroxiredoxin-like 2 activated in M-CSF stimulated monocytes; Peroxiredoxin-like 2A; PRO2290; Protein PAMM; PRXL2A; PSEC0139; Redox-regulatory protein FAM213A; redox-regulatory protein PAMM; RGD1309676; Shp1; similar to RIKEN cDNA 5730469M10; sperm head protein 1; UNQ611/PRO1198; UPF0765 protein C10orf58; UPF0765 protein C10orf58 homolog
• Common Name: FAM213A
• Gene Symbol: FAM213A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NTDVFLSKPQKAALEYLEDIDLKTLEKEPRTFKAKELWEKNGAVIMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTEVKDFQPYFKGE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining