Invitrogen™ Human FAM3C (aa 31-81) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100291	100 μL

Catalog No. RP100291 Supplier Invitrogen™ Supplier No. RP100291

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83654. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM3C is a 227 amino acid secretory protein that belongs to a novel cytokine-like family with sequence similarity to FAM3 family. FAM3C is a signaling cytokine with a GG domain, hydrophobic leader sequence and an N-terminal signal peptide. FAM3C has a cytokine activity and shows a change in expression in pancreatic cancer-derived cells. It is ubiquitously expressed in most of the tissues. Reports suggest that FAM3C plays an important role in inner ear development and may thus be involved in cell differentiation and proliferation during inner ear embryogenesis.

Specifications

• Accession Number: Q92520
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10447
• Name: Human FAM3C (aa 31-81) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: D6Wsu176e; FAM3 metabolism regulating signaling molecule C; Fam3c; fam3c protein; FAM3C-like protein; family with sequence similarity 3 member C; family with sequence similarity 3, member C; GS3786; Ilei; Interleukin-like EMT inducer; interleukin-like epithelial-mesenchymal transition inducer; predicted osteoblast protein; protein FAM3C; si:dkey-159a18.2; wu:fb99h11; wu:fi35h03; zgc:55444; zgc:77090
• Common Name: FAM3C
• Gene Symbol: FAM3C
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining