Invitrogen™ Human FAM53A (aa 14-109) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96742	100 μL

Catalog No. RP96742 Supplier Invitrogen™ Supplier No. RP96742

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57666. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dorsal neural-tube nuclear protein is a 398 amino acid nuclear protein. DNTNP is thought to play an important role in neural development by specifying dorsal cell fates within the neural tube. Widely expressed in the dorsal neural tube, DNTNP is most highly expressed in the dorsal regions of the midbrain, the hindbrain, the diencephalon, and the spinal neural tube and is expressed at lower levels in the branchial arches, the telencephalon, the heart, and somites of developing embryos. DNTNP is encoded by a gene located on chromosome 4 which contains many genes including the Huntingtin gene, which is found to encode an expanded glutamine tract in cases of Huntington's disease.

Specifications

• Accession Number: Q6NSI3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 152877
• Name: Human FAM53A (aa 14-109) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: DNTNP; Dorsal neural-tube nuclear protein; FAM53A; family with sequence similarity 53 member A; family with sequence similarity 53, member A; protein FAM53A
• Common Name: FAM53A
• Gene Symbol: FAM53A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LDDLTCKAEAGPLQYSAETLNKSGRLFPLELNDQSPWKVFSGGPPVRSQAATGPDFSFLPGLSAAAHTMGLQWQPQSPRPGAGLGAASTVDPSEST
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining