Invitrogen™ Human FAM72A (aa 12-62) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108173	100 μL

Catalog No. RP108173 Supplier Invitrogen™ Supplier No. RP108173

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83650. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM72A, also named as LMIP and UGENE, is a mitochondrial protein which regulates cellular reactive oxygen species metabolism. It is up-regulated in malignant colon cancers, compared to normal colon and colon adenomas. FAM72 has some members A/B/C/D with higher homology.

Specifications

• Accession Number: Q5TYM5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 729533
• Name: Human FAM72A (aa 12-62) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2700049P18Rik; dpr4-related protein; Fam72a; family with sequence similarity 72 member A; family with sequence similarity 72, member A; latent membrane protein 1-induced protein; LMP1-induced protein; LMPIP; MGC57827; P17; Protein FAM72A; RP11-312O7.1; Ugene
• Common Name: FAM72A
• Gene Symbol: FAM72A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining