Invitrogen™ Human FAM82A1 (aa 163-238) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102630	100 μL

Catalog No. RP102630 Supplier Invitrogen™ Supplier No. RP102630

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57024. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The human protein FAM82A1, also known as regulator of microtubule dynamics 2 (RMD2), was one of three proteins identified as related to a family of microtubule-associated proteins in C. elegans. FAM82A1 contains multiple coiled-coil domains and localize to the spindle microtubules and spindle poles during cell division. During interphase, RMD2 localizes to the cytoplasm with protein observed in the microtubule lattice and perinuclear region.

Specifications

• Accession Number: Q96LZ7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 151393
• Name: Human FAM82A1 (aa 163-238) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AW061290; BLOCK18; Fam82a; Fam82a1; family with sequence similarity 82, member A; family with sequence similarity 82, member A1; microtubule-associated protein; mRMD-2; PRO34163; Protein FAM82A1; PYST9371; regulator of microtubule dynamics 2; regulator of microtubule dynamics protein 2; RMD2; RMD-2; RMD4; Rmdn2; UNQ9371/PRO34163
• Common Name: FAM82A1
• Gene Symbol: RMDN2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SFPVPKAFNTRVEELNLDVLLQKVDHLRMSESGKSESFELLRDHKEKFRDEIEFMWRFARAYGDMYELSTNTQEKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining