Invitrogen™ Human FAM89B (aa 94-138) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100459	100 μL

Catalog No. RP100459 Supplier Invitrogen™ Supplier No. RP100459

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61367. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Negatively regulates TGF-beta-induced signaling; in cooperation with SKI prevents the translocation of SMAD2 from the nucleus to the cytoplasm in response to TGF-beta. Acts as an adapter that mediates the specific recognition of LIMK1 by CDC42BPA and CDC42BPB in the lamellipodia. LRAP25-mediated CDC42BPA/CDC42BPB targeting to LIMK1 and the lamellipodium results in LIMK1 activation and the subsequent phosphorylation of CFL1 which is important for lamellipodial F-actin regulation. [UniProt].

Specifications

• Accession Number: Q8N5H3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 23625
• Name: Human FAM89B (aa 94-138) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1110021A21Rik; C184L ORF2 protein; C184m; C184M protein; FAM89B; family with sequence similarity 89 member B; family with sequence similarity 89, member B; Leucine repeat adapter protein 25; leucine repeat adaptor protein 25; Lrap25; Mammary tumor virus receptor 2; mammary tumor virus receptor homolog 1; MMTV; MMTV receptor; MTVR; MTVR1; Mtvr2; protein FAM89B
• Common Name: FAM89B
• Gene Symbol: Fam89b
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RKEMLWGLYESIQDYKHLCQDLSFCQDLSSSLHSDSSYPPDAGLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining