Invitrogen™ Human FANCD2 (aa 253-348) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107284	100 μL

Catalog No. RP107284 Supplier Invitrogen™ Supplier No. RP107284

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FANCD2 (Fanconi anemia group D2 protein) is required for maintenance of chromosomal stability. It promotes accurate and efficient pairing of homologs during meiosis. FANCD2 is involved in the repair of DNA double-stranded breaks, both by homologous recombination and single-stranded annealing. It is required for the targeting/stabilization of BLM to non-centromeric abnormal structures induced by replicative stress. FANCD2 promotes BRCA2/FANCD1 loading onto damaged chromatin. Defects in the FANCD2 gene result in Fanconi anemia complementation group D2. This disorder affects all bone marrow elements resulting in anemia, leukopenia, and thrombopenia.

Specifications

• Accession Number: Q9BXW9
• Concentration: 2.20 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2177
• Name: Human FANCD2 (aa 253-348) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2410150O07Rik; AU015151; BB137857; DKFZp762A223; FA4; FACD; FACD2; FAD; FAD2; FA-D2; FANCD; FANCD2; Fanconi anemia complementation group D2; Fanconi anemia D2 protein; Fanconi anemia group D2 protein; Fanconi anemia group D2 protein homolog; Fanconi anemia, complementation group D2; FLJ23826; Protein FACD2
• Common Name: FANCD2
• Gene Symbol: FANCD2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining