Invitrogen™ Human FCGR2A (aa 245-317) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90301	100 μL

Catalog No. RP90301 Supplier Invitrogen™ Supplier No. RP90301

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (23%), Rat (23%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82405. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: P12318
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2212
• Name: Human FCGR2A (aa 245-317) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: CD16; CD32; CD32A; CDw32; Fc fragment of IgG low affinity IIa receptor for (CD32); Fc fragment of IgG receptor IIa; Fc fragment of IgG, low affinity IIa, receptor; Fc fragment of IgG, low affinity IIa, receptor (CD32); Fc gamma receptor IIa; Fc receptor, IgG, low affinity III; FCG2; fc-gamma RII-a; Fc-gamma RIII; fc-gamma-RIIa; FcGR; FCGR2; FCGR2A; FCGR2A1; Fcgr3; Fcgr3a; fcRII-a; fcRIII; FGCR; IGFR2; IgG Fc receptor II-a; igG Fc receptor III; Immunoglobulin G Fc receptor II; low affinity immunoglobulin gamma Fc region receptor II-a; Low affinity immunoglobulin gamma Fc region receptor III
• Common Name: CD32a (FCGR2A)
• Gene Symbol: FCGR2A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining