Invitrogen™ Human FGD4 (aa 120-205) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP97793	100 μL

Catalog No. RP97793 Supplier Invitrogen™ Supplier No. RP97793

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58706. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The FGD4 gene, also known as FYVE, RhoGEF, and PH domain-containing protein 4, is located on chromosome 12p11.21. This gene encodes a protein involved in the regulation of the actin cytoskeleton and is crucial for cellular processes such as migration and adhesion. FGD4 is specifically associated with Charcot-Marie-Tooth disease type 4H (CMT4H), a rare autosomal recessive hereditary neuropathy characterized by early onset, progressive distal muscle weakness, scoliosis, and myelin outfoldings. Mutations in FGD4 result in disruptions of its function, leading to the clinical manifestations of CMT4H. Additionally, the gene has been implicated in cancer biology, with its expression correlating with aggressive phenotypes in some cancers and contributing to therapeutic resistances. The gene includes multiple exons and alternative splicing variants, underlining its broad functional implications.

Specifications

• Accession Number: Q96M96
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 121512
• Name: Human FGD4 (aa 120-205) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Actin filament-binding protein frabin; actin-filament binding protein frabin; CMT4H; FGD1 family, member 4; FGD1-related F-actin-binding protein; FGD4; FRABP; FYVE, RhoGEF and PH domain containing 4; FYVE, RhoGEF and PH domain-containing protein 4; ZFYVE6; Zinc finger FYVE domain-containing protein 6
• Common Name: FGD4
• Gene Symbol: FGD4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPLLDTHIVNGERDETATAPASPTTDSCDGNASDSSYRTPGIGPVLPLEERGAETETKVQERENGESPLELEQLDQHHEMKETNEQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining