Invitrogen™ Human FGF12 (aa 210-242) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107824	100 μL

Catalog No. RP107824 Supplier Invitrogen™ Supplier No. RP107824

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67182. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported.

Specifications

• Accession Number: P61328
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2257
• Name: Human FGF12 (aa 210-242) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AV114868; B230343J05Rik; FGF; FGF12; FGF-12; FGF12B; FHF1; FHF-1; Fhf1b; Fibroblast growth factor; Fibroblast growth factor 12; fibroblast growth factor 12B; fibroblast growth factor FGF-12b; fibroblast growth factor homologous factor 1; fibroblast growth factor homologous factor 1b; myocyte-activating factor
• Common Name: FGF12
• Gene Symbol: Fgf12
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining