Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human FGF4 (aa 125-203) Control Fragment Recombinant Protein

Catalog No. RP89876
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89876 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89876 Supplier Invitrogen™ Supplier No. RP89876
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52804. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Fibroblast growth factor 4 (FGF4) is a member of the fibroblast growth factor (FGF) family that possess broad mitogenic and cell survival activities and play key roles in growth and survival of stem cells during embryogenesis, tissue regeneration, and carcinogenesis. FGF4 was identified by its strong oncogenic transforming activity and is a potent angiogenic factor, expressed in several highly vascularized tumors and also in adult mouse testis, intestine, and brain. Studies on the mouse homolog suggests a function in bone morphogenesis and limb development through the sonic hedgehog (SHH) signaling pathway. Furthermore, FGF4 regulates neural progenitor cell proliferation and neuronal differentiation. Recent studies show a growth-promoting role for FGF4 in human embryonic stem cells and a putative feedback inhibition mechanism by a novel FGF4 splice isoform that may serve to promote differentiation at a later stages of development.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P08620
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 2249
Name Human FGF4 (aa 125-203) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias FGF; FGF4; Fgf-4; Fgfk; Fibroblast growth factor; fibroblast growth factor 4; fibroblast growth factor 4 splice isoform; HBGF-4; heparin secretory transforming protein 1; heparin secretory-transforming protein 1; heparin-binding growth factor 1; heparin-binding growth factor 4; HST; Hst1; hst-1; HSTF1; HSTF-1; human stomach cancer, transforming factor from FGF-related oncogene; kaposi sarcoma oncogene; Kfgf; K-FGF; K-fibroblast growth factor; KS3; oncogene HST; transforming protein KS3
Common Name FGF4
Gene Symbol Fgf4
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.