Invitrogen™ Human FGFR4 (aa 740-794) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95217	100 μL

Catalog No. RP95217 Supplier Invitrogen™ Supplier No. RP95217

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FGFR4 is a member of the FGFR family of receptor tyrosine kinases. This family is known to regulate a host of cellular functions including angiogenesis, mitogenesis, osteogenesis, myogenesis, carcinogenesis, cellular differentiation, and tissue repair after injury. The FGFR family has also been implicated in a number of diseases including cancer, rheumatoid arthritis, and diabetic retinopathy. FGFR4 is required for normal down-regulation of the expression of CYP7A1, the rate-limiting enzyme in bile acid synthesis, in response to FGF19. FGFR4 plays a role in postnatal lung development and may be involved in the development of skeletal muscle cell lineages.

Specifications

• Accession Number: P22455
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2264
• Name: Human FGFR4 (aa 740-794) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: CD334; CTLA-2-beta protein; FGF Receptor; FGF Receptor 4; FGFR; Fgfr4; FGFR-4; Fibroblast growth factor receptor 4; fibroblast growth factor receptor 4 16 minus form; hydroxyaryl-protein kinase; JTK2; MGC20292; Mpk-11; protein-tyrosine kinase; protein-tyrosine kinase receptor MPK-11; TKF; tyrosine kinase related to fibroblast growth factor receptor; tyrosylprotein kinase
• Common Name: FGFR4
• Gene Symbol: Fgfr4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPLGSSSF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining