Invitrogen™ Human FGFR5 (aa 100-175) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107656	100 μL

Catalog No. RP107656 Supplier Invitrogen™ Supplier No. RP107656

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67015. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acidic and basic fibroblast growth factors (FGFs) are members of a family of multifunctional polypeptide growth factors that stimulate proliferation of cells of mesenchymal, epithelial and neuro-ectodermal origin. Like other growth factors, FGFs act by binding and activating specific cell surface receptors. A total of six members of the FGF receptor family have been identified and cloned. These include the Flg receptor or FGFR-1, the BEK receptor or FGFR-2, FGFR-3, FGFR-4, FGFR-5 and FGFR-6. These receptors usually contain an extracellular ligand-binding region containing three immunoglobulin-like domains, a transmembrane domain and a cytoplasmic tyrosine kinase domain. However, FGFR-5 lacks the cytoplasmic kinase domain. FGFR-5 is expressed in a broad range of tissues, including kidney, brain and lung, but it is preferentially expressed in pancreas, where it may play a role in the regulation of some pancreatic function.

Specifications

• Accession Number: Q8N441
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 53834
• Name: Human FGFR5 (aa 100-175) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: alpha-L-iduronidase; FGF homologous factor receptor; FGF receptor-like protein 1; Fgfr5; FGFR-5; FGFR5beta; FGFR5gamma; Fgfrl1; FGFR-like protein; FHFR; fibroblast growth factor receptor 5; Fibroblast growth factor receptor-like 1; fibroblast growth factor receptor-like protein; UNQ480/PRO943
• Common Name: FGFR5
• Gene Symbol: FGFRL1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVAS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining