Invitrogen™ Human FIR (aa 808-894) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106645	100 μL

Catalog No. RP106645 Supplier Invitrogen™ Supplier No. RP106645

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65956 (PA5-65956. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FARP2 (FERM, RhoGEF and pleckstrin domain-containing protein 2), also known as PLEKHC3 or FERM domain including RhoGEF (FIR), is a 1,545 amino acid protein that contains one FERM domain, one DH domain and two PH domains. It exists as two alternatively spliced isoforms that are abundantly expressed in brain, lung, and testis as well as in embryonic hippocampal and cortical neurons. FARP2 functions as a Rho-guanine nucleotide exchange factor that activates RAC1 and is thought to regulate neurite remodeling of embryonic neurons. Sema3A binding to neuropilin-1 induces the dissociation of FARP2 from plexin-A1, thereby activating FARP2's Rac GEF activity which is critical for repulsion of outgrowing axons and suppression of neuronal adhesion. Downregulation of the FARP2 gene has been implicated in autism.

Specifications

• Accession Number: O94887
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9855
• Name: Human FIR (aa 808-894) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI465173; BC009153; D030026M03Rik; Farp2; FERM domain including RhoGEF; FERM domain-including RhoGEF; FERM, ARH/RhoGEF and pleckstrin domain protein 2; FERM, ARHGEF and pleckstrin domain-containing protein 2; FERM, RhoGEF and pleckstrin domain protein 2; FERM, RhoGEF and pleckstrin domain-containing protein 2; FGD1-related Cdc42-GEF; Fir; FRG; Kiaa0793; mKIAA0793; PH domain-containing family C member 3; pleckstrin homology domain-containing family C member 3; PLEKHC3
• Common Name: FIR
• Gene Symbol: FARP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VEESDNEWSVPHCFTIYAAQKTIVVAASTRLEKEKWMLDLNSAIQAAKSGGDTAPALPGRTVCTRPPRSPNEVSLEQESEDDARGVR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining