Invitrogen™ Human FKBP4 (aa 94-215) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102154	100 μL

Catalog No. RP102154 Supplier Invitrogen™ Supplier No. RP102154

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FKBP4, encoding FK506-binding protein 4, is part of the immunophilin family and plays roles in cellular processes like protein folding and trafficking. The FKBP4 gene is located on chromosome 12, where it encodes a protein involved in modulating the androgen receptor signaling pathway and has been implicated in various cancers, including non-small-cell lung cancer (NSCLC) and hepatocellular carcinoma (HCC). Structural variants of FKBP4 found through exome sequencing have shown potential deleterious effects on protein function. This gene is associated with cell proliferation, apoptosis, migration, and invasion in cancer cells. FKBP4 also influences metabolic processes, such as glycolysis, thereby contributing to cancer cell survival and growth. Importantly, FKBP4 has a role in disorders of sexual development due to its regulatory interaction with hormone signaling pathways.

Specifications

• Accession Number: Q02790
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2288
• Name: Human FKBP4 (aa 94-215) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 51 kDa FK506-binding protein; 52 kDa FK506-binding protein; 52 kDa FKBP; 59 kDa immunophilin; 59kDa; AL022792; AW208983; FK506 binding protein 4; FK506 binding protein 4, 59kDa; FK506 binding protein 52; FK506-binding protein 4; FK506-binding protein 4 (59kD); FKBP prolyl isomerase 4; Fkbp4; FKBP-4; FKBP51; FKBP52; FKBP-52; FKBP52 protein; FKBP59; Fkpb52; HBI; HSP binding immunophilin; Hsp56; hsp90 binding protein; HSP-binding immunophilin; immunophilin FKBP52; p52; P59; p59 protein; peptidylprolyl cis-trans isomerase; peptidyl-prolyl cis-trans isomerase FKBP4; Peptidyl-prolyl cis-trans isomerase FKBP4, N-terminally processed; PPIase; PPIase FKBP4; rotamase; T-cell FK506-binding protein, 59kD
• Common Name: FKBP4
• Gene Symbol: FKBP4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining