Invitrogen™ Human FMRP (aa 317-373) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103247	100 μL

Catalog No. RP103247 Supplier Invitrogen™ Supplier No. RP103247

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FMR1 binds RNA and is associated with polysomes. The protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure. Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.

Specifications

• Accession Number: Q06787
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2332
• Name: Human FMRP (aa 317-373) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AT24755; BcDNA:GM08679; cg 6203 gene product from transcript cg6203-rc; cg6203; CG6203-PA; CG6203-PB; CG6203-PC; CG6203-PD; CG6203-PE; CG6203-PF; CG6203-PG; CG6203-PH; CG6203-PI; CG6203-PJ; CG6203-PK; dFMR; DFmr1; dFmrp; dfxr; dfxr1; dFXRP; Dmel\CG6203; Dmel_CG6203; dmfr1; drosophila fragile X mental retardation protein; EP(3)3517; FMR; FMR1; Fmr-1; Fmr1-PA; Fmr1-PB; Fmr1-PC; Fmr1-PD; Fmr1-PE; Fmr1-PF; Fmr1-PG; Fmr1-PH; Fmr1-PI; Fmr1-PJ; Fmr1-PK; FMRP; FMRP translational regulator 1; fragile X; fragile X mental retardation; fragile X mental retardation 1; fragile X mental retardation gene; fragile X mental retardation protein; fragile X mental retardation protein 1; Fragile X mental retardation protein 1 homolog; fragile X mental retardation related 1; fragile X mental retardation syndrome 1; fragile X mental retardation syndrome 1 homolog; Fragile X mental retardation syndrome-related protein 1; fragile X mental retardation-1 protein; fragile X protein; fragile x related; fragile X related protein; fragile X retardation 1 protein; fragile X-related; fragile-X; Fragile-X mental retardation 1; Fragile-X mental retardation protein; Fragile-X-related; FRAXA; FXR; MGC87458; POF; POF1; protein FMR-1; ragile X mental retardation protein; synaptic functional regulator FMR1
• Common Name: FMRP
• Gene Symbol: FMR1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RIEAENEKNVPQEEEIMPPNSLPSNNSRVGPNAPEEKKHLDIKENSTHFSQPNSTKV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining