Invitrogen™ Human FN3KRP (aa 83-178) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103613	100 μL

Catalog No. RP103613 Supplier Invitrogen™ Supplier No. RP103613

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-66002, PA5-64249. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Fructosamine-3-kinase related protein (FN3KRP) is located on chromosome 17q25.3, approximately 8 kb upstream of the FN3K gene. It shares 65% amino acid identity with FN3K and possesses an identical genomic organization, implying functional similarities; FN3KRP is suggested to play a role in enzymatic deglycation. Unlike FN3K, FN3KRP is more ancient, present in diverse organisms such as cyanobacteria, echinoderms, plants, and cold-blooded vertebrates. Studies have discovered a significant association between rs1046896 in FN3KRP and longevity, where the longevity allele C is linked to increased FN3KRP expression in whole blood. FN3KRP is hypothesized to phosphorylate glucitolamines, products of non-enzymatic glycation, indicating its involvement in crucial metabolic processes. The regulation of both FN3K and FN3KRP is notable for TATA-less and CAAT-less promoters, featuring homologous CpG islands and Sp1 binding sites. Meanwhile, both genes are widely expressed across human tissues, but FN3K demonstrates significantly higher levels in tissues prone to glycation-related complications.

Specifications

• Accession Number: Q9HA64
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 79672
• Name: Human FN3KRP (aa 83-178) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: FN3KL; FN3K-related protein; Fn3krp; FN3K-RP; fructosamine 3 kinase related protein; fructosamine 3-kinase-related protein; fructosamine-3-kinase-related protein; Ketosamine-3-kinase; ortholog of human fructosamine-3-kinase-related protein FN3KRP; Protein-psicosamine 3-kinase FN3KRP; RGD1304570; testis secretory sperm-binding protein Li 211a
• Common Name: FN3KRP
• Gene Symbol: FN3KRP
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGTVGRGGGQEERPFVARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQMD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining