Invitrogen™ Human FNDC3A (aa 777-910) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90046	100 μL

Catalog No. RP90046 Supplier Invitrogen™ Supplier No. RP90046

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-140045, PA5-52990. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FNDC3A gene ontology annotations related to this gene include cell-cell adhesion; fertilization; Sertoli cell development; spermatid development.

Specifications

• Accession Number: Q9Y2H6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 22862
• Name: Human FNDC3A (aa 777-910) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1700094E19Rik; bA203I16.1; bA203I16.5; D14Ertd453e; F730017H24Rik; fibronectin domain-containing protein 3a; fibronectin type III domain containing 3a; fibronectin type-III domain-containing protein 3A; FNDC3; fndc3a; HUGO; Human gene expressed in odontoblasts; KIAA0970; sys; wu:fk65b04; zmp:0000001126
• Common Name: FNDC3A
• Gene Symbol: FNDC3A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VNWEVPLSNGTDVTEYRLEWGGVEGSMQICYCGPGLSYEIKGLSPATTYYCRVQALSVVGAGPFSEVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILAYSIDFGDKQSLTVGKV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining