Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human FNTA (aa 58-125) Control Fragment Recombinant Protein

Catalog No. RP101897
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101897 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101897 Supplier Invitrogen™ Supplier No. RP101897
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53858. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FNTA (Farnesyltransferase, CAAX box; alphaCAAX farnesyltransferase alpha subunit, FPTA, FTase-alpha, GGTase-I-alpha, Protein farnesyl transferase/ geranyl geranyl transferase type I alpha subunit(PGGT1A), Ras proteins prenyl transferase alpha, Type I protein geranyl-geranyl transferase alpha subunit) is located locus 8p11 (human). Prenylation is a common intracellular posttranslational protein modification catalyzed by prenyltransferases. The best characterized among these prenyltransferases is the CAAX farnesyl transferase (2. 5. 1. 21), which is alpha-beta heterodimeric enzyme. It catalyzes the attachment of a farnesyl group from farnesyl phosphate to cysteine residues at the fourth position from the C terminus of proteins that end in the CAAX box. FNTA or the alpha subunit of farnesyl transferase is shared by the geranyl-geranyl protein transferases. Apart from transfer of farnesyl and geranyl groups to proteins, FNTA has been proposed to regulate intracellular signaling pathways involving p21ras. Reports have shown that FNTA interacts with TGF-beta and activin-type I receptors.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P49354
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 2339
Name Human FNTA (aa 58-125) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias CAAX farnesyltransferase subunit alpha; farnesyl-protein transferase alpha-subunit; farnesyltransferase, CAAX box, alpha; Farnesyltransferase, subunit alpha; Fnta; FPTA; FTA; FTase-alpha; GGTase-I-alpha; PFAS; PGGT1A; Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; protein prenyltransferase alpha subunit repeat containing 2; PTAR2; Ras proteins prenyltransferase subunit alpha; type I protein geranyl-geranyltransferase alpha subunit; type I protein geranyl-geranyltransferase subunit alpha
Common Name FNTA
Gene Symbol FNTA
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LDSPSYVLYRHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.