Invitrogen™ Human FOXQ1 (aa 175-218) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103618	100 μL

Catalog No. RP103618 Supplier Invitrogen™ Supplier No. RP103618

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111493. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FOXQ1 is a member of the FOX gene family, which is characterized by a conserved 110-amino acid DNA-binding motif called the forkhead or winged helix domain. FOX genes are involved in embryonic development, cell cycle regulation, tissue-specific gene expression, cell signaling, and tumorigenesis.

Specifications

• Accession Number: Q9C009
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 94234
• Name: Human FOXQ1 (aa 175-218) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: forkhead box protein Q1; forkhead box Q1; FOXQ1; Hepatocyte nuclear factor 3 forkhead homolog 1; Hfh1; HFH-1; Hfh1l; HFH-1l; HNF-3/forkhead homolog 1 like; HNF-3/forkhead homolog-1; HNF-3/forkhead-like protein 1; sa; satin; winged helix/forkhead transcription factor
• Common Name: FOXQ1
• Gene Symbol: FOXQ1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining