Invitrogen™ Human FRS3 (aa 297-391) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94865	100 μL

Catalog No. RP94865 Supplier Invitrogen™ Supplier No. RP94865

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56385. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FRS3 (fibroblast growth factor receptor substrate 3), also known as FRS2B (FRS2-beta), is a 492 amino acid lipid-anchor adapter protein that contains one IRS-type PTB domain. Colocalizing to neural tissues with Tuj1, FRS3 functions as a feedback inhibitor of EGFR family members by preventing heterodimer formation between EGFR and ErbB2, thereby acting as a potential tumor suppressor. FRS3 is phosphorylated upon stimulation by FGF-2 or NGF and, acting as an adapter protein, links c-Fgr and NGF receptors to downstream signaling pathways. Interfering with the phosphorylation and nuclear translocation of ERK-2, FRS3 down-regulates ERK-2 expression. FRS3 likely interacts directly with GRB2, SH-PTP2, Flg, and Trk A, and may be involved in MAP kinase activation.

Specifications

• Accession Number: O43559
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10817
• Name: Human FRS3 (aa 297-391) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4930417B13Rik; AI449674; FGFR substrate 3; FGFR-signaling adaptor SNT2; Fibroblast growth factor receptor substrate 3; FRS2B; Frs2beta; FRS2-beta; FRS3; Snt2; SNT-2; Suc1-associated neurotrophic factor target 2; suc1-associated neurotrophic factor target 2 (FGFR signalling adaptor); testicular tissue protein Li 71
• Common Name: FRS3
• Gene Symbol: FRS3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GAGWRLSPEEPGWNGLAHRRAALLHYENLPPLPPVWESQAQQLGGEAGDDGDSRDGLTPSSNGFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining