Invitrogen™ Human FRYL (aa 2848-2926) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95480	100 μL

Catalog No. RP95480 Supplier Invitrogen™ Supplier No. RP95480

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56644. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FRYL gene ontology annotations related to this gene include cell morphogenesis.

Specifications

• Accession Number: O94915
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 285527
• Name: Human FRYL (aa 2848-2926) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2010313D22Rik; 2310004H21Rik; 2510002A14Rik; 9030227G01Rik; AF4p12; ALL1-fused gene from chromosome 4p12 protein; DKFZp686E205; FRY like; FRY like transcription coactivator; FRYL; FRY-like; furry homolog-like; furry homolog-like (Drosophila); furry-like; KIAA0826; mKIAA0826; MOR2; mor2 cell polarity protein homolog; protein furry homolog-like; RGD1311309
• Common Name: FRYL
• Gene Symbol: FRYL
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AYCKLINQVNTIKNEAEVINMSEELAQLESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining