Invitrogen™ Human FSTL3 (aa 27-101) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100061	100 μL

Catalog No. RP100061 Supplier Invitrogen™ Supplier No. RP100061

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60983. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Follistatin-like 3 (FSTL3) is a gene located on chromosome 19p13.3 and encodes a secreted glycoprotein that belongs to the follistatin-related protein family. FSTL3 functions as an antagonist to members of the transforming growth factor-beta (TGF-β) superfamily, particularly inhibiting activin and myostatin signaling. This inhibitory action is crucial for regulating muscle growth, fertility, and inflammation. FSTL3 is expressed in various tissues, including the placenta, gonads, and skeletal muscle, where it modulates physiological processes by binding to and neutralizing the activities of its target ligands. Dysregulation of FSTL3 has been implicated in conditions such as muscle wasting, metabolic syndrome, and reproductive disorders, reflecting its role in maintaining tissue homeostasis and function. Research into FSTL3 focuses on its potential therapeutic applications in diseases involving TGF-β pathway dysregulation, offering insights into strategies for modulating growth factor activities in clinical settings.

Specifications

• Accession Number: O95633
• Concentration: 4.20 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10272
• Name: Human FSTL3 (aa 27-101) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: E030038F23Rik; FLRG; FLRGFSRP; follistatin like 3; follistatin-like 3; follistatin-like 3 (secreted glycoprotein); follistatin-like protein 3; Follistatin-related gene protein; follistatin-related protein 3; FSRP; FSTL3; UNQ674/PRO1308
• Common Name: FSTL3
• Gene Symbol: FSTL3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining