Invitrogen™ Human FTO (aa 400-484) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104729	100 μL

Catalog No. RP104729 Supplier Invitrogen™ Supplier No. RP104729

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83535. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FTO is a novel protein and a member of the non-heme dioxygenase (Fe(II)-and 2-oxoglutarate-dependent dioxygenases) superfamily. Amino acid conservation patterns support this hypothesis and indicates that both 2-oxoglutarate and iron should be important for FTO function. Though not much is yet known about FTO, it is thought that the protein may somehow modify the activity of genes involved in metabolism and fat storage, which in turn may influence a person's risk of obesity.

Specifications

• Accession Number: Q9C0B1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 79068
• Name: Human FTO (aa 400-484) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AlkB homolog 9; ALKBH9; alpha-ketoglutarate-dependent dioxygenase FTO; AW743446; BMIQ14; fat mass and obesity associated; fat mass and obesity-associated protein; fatso; FTO; GDFD; KIAA1752; m6A(m)-demethylase FTO; MGC5149; mKIAA1752; mRNA (2'-O-methyladenosine-N(6)-)-demethylase FTO; mRNA N(6)-methyladenosine demethylase FTO; Protein fatso; protein fto; RGD1305121; tRNA N1-methyl adenine demethylase FTO; U6 small nuclear RNA (2'-O-methyladenosine-N(6)-)-demethylase FTO; U6 small nuclear RNA N(6)-methyladenosine-demethylase FTO
• Common Name: FTO
• Gene Symbol: Fto
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining