Invitrogen™ Human FTSJ3 (aa 518-581) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107179	100 μL

Catalog No. RP107179 Supplier Invitrogen™ Supplier No. RP107179

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84559. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Although the function of this gene is not known, the existence of this gene is supported by mRNA and EST data. A possible function of the encoded protein can be inferred from amino acid sequence similarity to the E.coli FtsJ protein and to a mouse protein possibly involved in embryogenesis.

Specifications

• Accession Number: Q8IY81
• Concentration: 3.14 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 117246
• Name: Human FTSJ3 (aa 518-581) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2'-O-ribose RNA methyltransferase SPB1 homolog; 2'-O-ribose RNA methyltransferase SPB1 homolog {ECO:0000255; AA537063; AU045295; C79843; D11Ertd400e; ectoplacental cone, invasive trophoblast giant cells, extraembryonic ectoderm and chorion sequence 3; Epcs3; FLJ20062; FtsJ homolog 3; FtsJ homolog 3 (E. coli); FtsJ RNA 2'-O-methyltransferase 3; FtsJ RNA methyltransferase homolog 3; FTSJ3; HAMAP-Rule:MF_03163}; pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3; pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3; pre-rRNA processing protein FTSJ3; pre-rRNA processing protein FTSJ3; pre-rRNA processing protein FTSJ3 {ECO:0000255; protein ftsJ homolog 3; Putative rRNA methyltransferase 3; putative rRNA methyltransferase 3 {ECO:0000255; rRNA (uridine-2'-O-)-methyltransferase 3; SB92; SPB1; SPB1 RNA methyltransferase homolog
• Common Name: FTSJ3
• Gene Symbol: FTSJ3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KAVLQEEQANLWFSKGSFAGIEDDADEALEISQAQLLFENRRKGRQQQQKQQLPQTPPSCLKTE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining