Invitrogen™ Human FUZ (aa 329-416) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98850	100 μL

Catalog No. RP98850 Supplier Invitrogen™ Supplier No. RP98850

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59724. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FUZ is the human homolog of Drosophila fy protein and belongs to the fuzzy family. The fy gene of Drosophila encodes a novel four-pass transmembrane protein that plays two roles in the development of hairs on the Drosophila wing. The first is to specify the correct orientation of the hair by restricting its initiation to the distal vertex of the cell. The second role is to permit the development of just a single cell hair by maintaining the integrity of the F-actin and microtubule arrays that are required for hair development. In humans, the protein is involved in cytoskeleton function and cell polarity in epithelial cells. The human fuz gene is localized on chromosome 19q13.33.

Specifications

• Accession Number: Q9BT04
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 80199
• Name: Human FUZ (aa 329-416) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2600013E07Rik; b2b1273Clo; Fuz; fuzzy homolog; fuzzy homolog (Drosophila); fuzzy planar cell polarity protein; FY; NTD; Protein fuzzy homolog; RGD1310608
• Common Name: FUZ
• Gene Symbol: FUZ
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLRNFYTLVTSTHFPPEPGPPEKTEDEVYQAQLPRACYLVLGTEEPGTGVRLVALQLGLRRLLLLLSPQSPTHGLRSLATHTLHALTP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining