Invitrogen™ Human FXYD6 (aa 58-90) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98833	100 μL

Catalog No. RP98833 Supplier Invitrogen™ Supplier No. RP98833

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59521. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes phosphohippolin, which likely affects the activity of Na,K-ATPase. Multiple alternatively spliced transcript variants encoding the same protein have been described. Related pseudogenes have been identified on chromosomes 10 and X. Read-through transcripts have been observed between this locus and the downstream sodium/potassium-transporting ATPase subunit gamma (FXYD2, GeneID 486) locus.

Specifications

• Accession Number: Q9H0Q3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 53826
• Name: Human FXYD6 (aa 58-90) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 0610030I18Rik; FXYD domain containing ion transport regulator 6; FXYD domain-containing ion transport regulator 6; Fxyd6; Phosphohippolin; Php; PLM-like protein; Plp; UNQ521/PRO1056; Vascular endothelial cell-specific protein 6; VESP6
• Common Name: FXYD6
• Gene Symbol: FXYD6
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SRRCKCSFNQKPRAPGDEEAQVENLITANATEP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining