Invitrogen™ Human GABRG3 (aa 17-59) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101533	100 μL

Catalog No. RP101533 Supplier Invitrogen™ Supplier No. RP101533

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111385. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GABRG3 is a family of proteins involved in the GABAergic neurotransmission of the mammalian central nervous system. GABRG3 is a member of the GABA-A receptor gene family of heteromeric pentameric ligand-gated ion channels through which GABA, the major inhibitory neurotransmitter in the mammalian brain, acts. GABA-A receptors are the site of action of a number of important pharmacologic agents including barbiturates, benzodiazepines, and ethanol (summary by Whiting et al., 1999). For additional general information about the GABA-A receptor gene family, see GABRA1 (MIM 137160).

Specifications

• Accession Number: Q99928
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2567
• Name: Human GABRG3 (aa 17-59) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: B230362M20Rik; CAE2; ECA2; GABA(A) receptor subunit gamma-3; GABA(G) receptor; GABA(G) receptor, gamma 3; GABA-alpha receptor gamma-3 subunit; GABRG3; Gabrg-3; gamma-aminobutyric acid; gamma-aminobutyric acid (GABA) A receptor, gamma 3; gamma-aminobutyric acid (GABA) A receptor, subunit gamma 3; gamma-aminobutyric acid (GABA-A) receptor, subunit gamma 3; gamma-aminobutyric acid A receptor, gamma 3; gamma-aminobutyric acid receptor subunit gamma-3; gamma-aminobutyric acid type A receptor gamma3 subunit; GEFSP3
• Common Name: GABRG3
• Gene Symbol: GABRG3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining