Invitrogen™ Human GADD45B (aa 22-154) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90634	100 μL

Catalog No. RP90634 Supplier Invitrogen™ Supplier No. RP90634

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56268. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cellcycle progression issubject to arrest at G1 and G2 checkpointsin response to DNA damage, presumablyto allow time for DNA repair prior to entryinto S andMphase, respectively. The p53 tumorsuppressor isrequired for one such G1 checkpoint and functionsto upregulate expression of GADD 45 and p21. GADD 45 binds both Cdks and PCNA, a protein involved in DNA replication and repair. GADD 45 stimulates DNA excision repair in vitro and inhibits entry ofcellsinto S phase. Thus, it has been suggested that GADD 45 mayserve as a link between the p53-dependentcellcycle checkpoint and DNA repair. GADD 45-like proteins, GADD 45 beta and GADD 45 gamma, have been shown to be induced by environmentalstresses. GADD 45 beta and GADD 45 gamma are thought to induce p38/JNK activation via MEKK4 activation.

Specifications

• Accession Number: O75293
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4616
• Name: Human GADD45B (aa 22-154) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI323528; DKFZP566B133; Gadd45b; GADD45BETA; growth arrest and DNA damage inducible beta; growth arrest and DNA damage-inducible protein GADD45 beta; growth arrest and DNA-damage-inducible 45 beta; growth arrest and DNA-damage-inducible protein GADD45 beta; growth arrest and DNA-damage-inducible, beta; MYD118; myeloid differentiation primary response; myeloid differentiation primary response gene 118; myeloid differentiation primary response protein MyD118; Negative growth regulatory protein MyD118; Unknown (protein for MGC:138134)
• Common Name: GADD45B
• Gene Symbol: GADD45B
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining