Invitrogen™ Human GAGE1 (aa 20-56) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104354	100 μL

Catalog No. RP104354 Supplier Invitrogen™ Supplier No. RP104354

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (39%), Rat (39%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60286. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The GAGE1 cDNA contains a 143-bp insertion, located in the coding sequence near the termination codon, that is absent from the other cDNAs. The antigenic peptide YRPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. Nothing is presently known about the function of this protein. An alternatively spliced transcript variant has been found for this gene.

Specifications

• Accession Number: P0DTW1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2543
• Name: Human GAGE1 (aa 20-56) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Antigen MZ2-F; Cancer/testis antigen 4.1; cancer/testis antigen 4.5; cancer/testis antigen family 4, member 1; cancer/testis antigen family 4, member 5; CT4.1; CT4.5; G antigen 1; G antigen 5; GAGE1; GAGE-1; GAGE5; GAGE-5; MZ2-F antigen
• Common Name: GAGE1
• Gene Symbol: GAGE1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining