Invitrogen™ Human Galectin 8 (aa 18-164) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102144	100 μL

Catalog No. RP102144 Supplier Invitrogen™ Supplier No. RP102144

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83145. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.

Specifications

• Accession Number: O00214
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3964
• Name: Human Galectin 8 (aa 18-164) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1200015E08Rik; 30 kDa S-type lectin; AI326142; D13Ertd524e; Gal-8; galectin 8; galectin-8; galectin-8g; galectin-8L; lectin, galactose binding, soluble 5; lectin, galactose binding, soluble 8; lectin, galactoside binding soluble 8; lectin, galactoside-binding, soluble, 8; LGALS8; Lgals-8; PCTA1; PCTA-1; Po66 carbohydrate binding protein; po66 carbohydrate-binding protein; Po66-CBP; prostate carcinoma tumor antigen 1; RL-30; RP11-385F5.1
• Common Name: Galectin 8
• Gene Symbol: Lgals8
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining