Invitrogen™ Human GALNT16 (aa 489-557) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101145	100 μL

Catalog No. RP101145 Supplier Invitrogen™ Supplier No. RP101145

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63666. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GALNTL1 belongs to the glycosyltransferase 2 family, GalNAc-T subfamily. It contains 1 ricin B-type lectin domain. GALNTL1 may catalyze the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.

Specifications

• Accession Number: Q8N428
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 57452
• Name: Human GALNT16 (aa 489-557) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5730405L21Rik; AI415388; GALNACT16; galNAc-T16; GalNAc-T-like protein 1; GALNT16; GALNTL1; KIAA1130; MGC141855; mpp-GalNAc-T16; Polypeptide GalNAc transferase 16; polypeptide GalNAc transferase-like protein 1; Polypeptide N-acetylgalactosaminyltransferase 16; polypeptide N-acetylgalactosaminyltransferase-like 1; polypeptide N-acetylgalactosaminyltransferase-like protein 1; pp-GaNTase-like protein 1; protein-UDP acetylgalactosaminyltransferase-like protein 1; putative polypeptide N-acetylgalactosaminyltransferase-like protein 1; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 1; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 16; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 1
• Common Name: GALNT16
• Gene Symbol: GALNT16
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ATSTLMSSPGSPVILQMCNPREGKQKWRRKGSFIQHSVSGLCLETKPAQLVTSKCQADAQAQQWQLLPH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining