Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP90680

Invitrogen™ Human GAP43 (aa 41-146) Control Fragment Recombinant Protein

Catalog No. RP90680
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90680 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90680 Supplier Invitrogen™ Supplier No. RP90680
Only null left
Add to Cart
Add to Cart

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110801 (PA5-110801. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GAP43 (Neuromodulin) is associated with nerve growth. GAP43 is expressed by developing and regenerating neurons, and to a lesser extent reactive glial cells. It is a major component of the motile 'growth cones' that form the tips of elongating axons. GAP43 also plays a role in axonal and dendritic filopodia induction.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P17677
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2596
Name Human GAP43 (aa 41-146) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Axonal membrane protein GAP-43; B-50; Basp2; brain abundant, membrane attached signal protein 2; calmodulin-binding protein P-57; Gap43; GAP-43; growth accentuating protein 43; growth associated protein 43; growth-associated protein 43; MGC156666; nerve growth-related peptide GAP43; neural phosphoprotein B-50; Neuromodulin; neuron growth-associated protein 43; neuron protein F1; PP46; Protein F1
Common Name GAP43
Gene Symbol GAP43
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.