Invitrogen™ Human GAS2L3 (aa 283-387) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP97771	100 μL

Catalog No. RP97771 Supplier Invitrogen™ Supplier No. RP97771

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61776. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cytoskeletal linker protein. May promote and stabilize the formation of the actin and microtubule network.

Specifications

• Accession Number: Q86XJ1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 283431
• Name: Human GAS2L3 (aa 283-387) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 8430435B07Rik; fc11d07; G2L3; GAS2L3; gas2l3b; GAS2-like protein 3; Gm240; growth arrest specific 2 like 3; growth arrest-specific 2 like 3; growth arrest-specific protein 2-like 3; si:ch211-203h15.1; wu:fc11d07
• Common Name: GAS2L3
• Gene Symbol: GAS2L3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LQFATLEQKILAFQKGVSNESVPDSPARTPQPPEMNPLSAVNMFQKQNSKPSVPVSIPKSKEKQGRPPGALVPASSLKGGNLGSMSVRSKLPNSPAASSHPKLKS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining