Invitrogen™ Human GDF15 (aa 30-169) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90652	100 μL

Catalog No. RP90652 Supplier Invitrogen™ Supplier No. RP90652

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GDF-15 belongs to the TGF-beta cytokine family, whose members play an important role during prenatal development and postnatal growth, and the remodeling and maintenance of a variety of tissues and organs. GDF-15 is expressed predominantly in the placenta and, to a much lesser extent, in various other tissues. The presence of GDF-15 in amniotic fluid and its elevated levels in the sera of pregnant women suggest GDF-15's involvement in gestation and embryonic development. GDF-15 generally exerts tumor suppressive activities and is one of the predominant factors produced and secreted in response to activation of the p53 pathway. Interestingly, the serum level of GDF-15 is positively correlated with neoplastic progression of several tumor types, including certain colorectal, pancreatic, and prostate cancers.

Specifications

• Accession Number: Q99988
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9518
• Name: Human GDF15 (aa 30-169) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Gdf15; GDF-15; growth differentiation factor 15; growth/differentiation factor 15; macrophage inhibiting cytokine-1; macrophage inhibitory cytokine 1; MIC1; MIC-1; NAG1; NAG-1; NRG-1; NSAID (nonsteroidal anti-inflammatory drug)-activated protein 1; NSAID-activated gene 1 protein; NSAID-regulated gene 1 protein; PDF; PLAB; Placental bone morphogenetic protein; placental TGF-beta; Prostate differentiation factor; PTGFB; PTGF-beta; SBF
• Common Name: GDF15
• Gene Symbol: Gdf15
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining