Invitrogen™ Human Glucagon (aa 21-95) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102745	100 μL

Catalog No. RP102745 Supplier Invitrogen™ Supplier No. RP102745

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83352. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glucagon is a 29-residue polypeptide hormone (MW 3482), produced in the pancreas. A related hormone, enteroglucagon (or oxyntomodulin), which is produced in the mucosa of the small and large intestine, consists of the 29 amino acid sequence of pancreatic glucagon extended by 8 additional residues at the C-terminus. The biological activities of pancreatic glucagon include glycogenolysis, lipolysis, gluconeogenesis, and ketogensis, which are antagonistic effects to those of insulin action, thus leading to increased blood glucose levels. Immunocytochemical studies have revealed the presence of pancreatic glucagon inside the A or alpha cells, which constitute 15-20% of the islet cell population. These cells are located preferentially at the periphery of the human pancreatic islets. Pathological manifestations of the glucagon-type peptide residue almost exclusively with the exsistence of tumors or glucagonomas, as no states of glucagon-cell deficiency or hyperplasia have been identified. Glucagon-specific antibodies would prove useful as a cell and tumor markers applying immunohistochemical techniques, and as an analytical tool in qualification of the hormone.

Specifications

• Accession Number: P01275
• Concentration: 4.3 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2641
• Name: Human Glucagon (aa 21-95) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: GCG; Glicentin; Glicentin-related polypeptide; GLP1; GLP-1; GLP-1(7-36); GLP-1(7-37); GLP1/2; GLP2; GLP-2; Glu; glucagon; Glucagon-like peptide 1; Glucagon-like peptide 1(7-36); Glucagon-like peptide 1(7-37); Glucagon-like peptide 2; glucagon-like peptide-1; GRPP; IL12p35; IL12P40; Incretin hormone; OXM; OXY; Oxyntomodulin; porcine proglucagon; PPG; preproglucagon; proglucagon
• Common Name: Glucagon
• Gene Symbol: Gcg
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining