Invitrogen™ Human Glucocorticoid Receptor (aa 2-149) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102328	100 μL

Catalog No. RP102328 Supplier Invitrogen™ Supplier No. RP102328

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glucocorticoid Receptor (NR3C1) is a receptor for glucocorticoids that can act as both a transcription factor and as a regulator of other transcription factors. Glucocorticoid Receptor can also be found in heteromeric cytoplasmic complexes along with heat shock factors and immunophilins. The protein is typically found in the cytoplasm until it binds a ligand, which induces transport into the nucleus. Glucocorticoid Receptor is expressed in the heart, detected in left and right atria, left and right ventricles, aorta, apex, intraventricular septum, and atrioventricular node as well as whole adult and fetal heart. Alternate splicing, the use of at least three different promoters, and alternate translation initiation sites result in several transcript variants encoding the same protein or different isoforms, but the full-length nature of some variants has not been determined. Mutations in the Glucocorticoid Receptor gene are a cause of glucocorticoid resistance, or cortisol, resistance. Studies have shown that glucocorticoid receptor (GR) must be associated with a complex of chaperone proteins for ligand activation. GR binds to known steroids such as dexamethasone with nanomolar affinity.

Specifications

• Accession Number: P04150
• Concentration: 2.4 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2908
• Name: Human Glucocorticoid Receptor (aa 2-149) Control Fragment
• pH Range: 7.4
• Purification Method: Metal-chelate chromatography
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: cytosolic/nuclear receptor; fb13f09; GCCR; Gcr; GCRST; glucocorticoid nuclear receptor variant 1; glucocorticoid receptor; glucocorticoid receptor 1; glucocorticoid receptor alpha; GR; gr alpha; GR Kit; Grl; Grl1; Grl-1; Nr3c1; Nuclear receptor subfamily 3 group C member 1; nuclear receptor subfamily 3, group C, member 1; nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor); OTTHUMP00000222854; OTTHUMP00000222858; utouto; utut; wu:fb13f09; zgc:113038
• Common Name: Glucocorticoid Receptor (Nr3c1)
• Gene Symbol: Nr3c1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining