Invitrogen™ Human GluR4 (aa 177-230) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109960	100 μL

Catalog No. RP109960 Supplier Invitrogen™ Supplier No. RP109960

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144906. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutamate receptors mediate most excitatory neurotransmission in the brain and play an important role in neural plasticity, neural development and neurodegeneration. Ionotropic glutamate receptors are categorized into NMDA receptors and kainate/AMPA receptors, both of which contain glutamate-gated, cation-specific ion channels. Kainate/AMPA receptors are co-localized with NMDA receptors in many synapses and consist of seven structurally related subunits designated GluR-1 to -7. The kainate/AMPA receptors are primarily responsible for the fast excitatory neuro-transmission by glutamate, whereas the NMDA receptors are functionally characterized by a slow kinetic and a high permeability for Ca2+ ions.

Specifications

• Accession Number: P48058
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2893
• Name: Human GluR4 (aa 177-230) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AMPA-selective glutamate receptor 4; GluA4; GLUR4; Glur-4; GLUR4C; Gluralpha4; GLURD; GluR-D; glutamate ionotropic receptor AMPA type subunit 4; glutamate receptor; glutamate receptor 4; glutamate receptor channel alpha 4; glutamate receptor ionotropic, AMPA 4; glutamate receptor, ionotrophic, AMPA 4; glutamate receptor, ionotropic, AMPA 4; glutamate receptor, ionotropic, AMPA4 (alpha 4); Gria4; spike wave 1; spkw1
• Common Name: GluR4
• Gene Symbol: Gria4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining