Invitrogen™ Human GLYR1 (aa 355-440) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103065	100 μL

Catalog No. RP103065 Supplier Invitrogen™ Supplier No. RP103065

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62141. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GLYR1 may have oxidoreductase activity. It regulates p38 MAP kinase activity by mediating stress activation of p38alpha/MAPK14 and specifically regulating MAPK14 signaling. It indirectly promotes phosphorylation of MAPK14 and activation of ATF2. The phosphorylation of MAPK14 requires upstream activity of MAP2K4 and MAP2K6. It is recruited on chromatin, recognizes and binds trimethylated 'Lys-36' of histone H3 (H3K36me3).

Specifications

• Accession Number: Q49A26
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 84656
• Name: Human GLYR1 (aa 355-440) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2810419J22Rik; 3930401k13rik; 3-hydroxyisobutyrate dehydrogenase-like protein; AW545332; BM045; Cytokine-like nuclear factor N-PAC; glyoxylate reductase 1 homolog; glyoxylate reductase 1 homolog (Arabidopsis); GLYR1; HIBDL; hNDF; NDF; NP60; Npac; N-pac; nuclear protein 60 kDa; nuclear protein 60kDa; nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; Putative oxidoreductase GLYR1; RGD1309459
• Common Name: GLYR1
• Gene Symbol: GLYR1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining