Invitrogen™ Human GM-CSF (aa 26-83) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106775	100 μL

Catalog No. RP106775 Supplier Invitrogen™ Supplier No. RP106775

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The GM-CSF gene encodes for a cytokine that regulates the production, differentiation, and function of macrophages and granulocytes. The active form of the protein exists as a homodimer in the extracellular space. This gene is located in a cluster of related genes at the chromosome region 5q31, which has been associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include interleukins 4, 5, and 13. The gene is involved in promoting tissue inflammation. Elevated levels of cytokines, including the one produced by this gene, have been observed in SARS-CoV-2 infected patients with acute respiratory distress syndrome. Mice that lack this gene or its receptor have been shown to develop pulmonary alveolar proteinosis.

Specifications

• Accession Number: P04141
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1437
• Name: Human GM-CSF (aa 26-83) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: colony stimulating factor 2; colony stimulating factor 2 (granulocyte-macrophage); colony-stimulating factor; CSF; CSF2; Csfgm; cytokine; GMCSF; Gm-CSf; granulocyte macrophage colony stimulating factor; granulocyte macrophage-colony stimulating factor; granulocyte-macrophage colony stimulating factor 2; granulocyte-macrophage colony-stimulating factor; MGC131935; MGC138897; MGC151255; MGC151257; MGI-IGM; M-GM-CSF; molgramostin; put. GM-CSF; sargramostim
• Common Name: GM-CSF
• Gene Symbol: CSF2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: STQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining