Invitrogen™ Human GORAB (aa 80-157) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94148	100 μL

Catalog No. RP94148 Supplier Invitrogen™ Supplier No. RP94148

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55557. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TCEB1 is known as protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Western blots using two different antibodies (P100962-T200 and P100963_P050 / P100963_P100) against two unique regions of this protein target confirm the same apparent molecular weight in our tests.

Specifications

• Accession Number: Q5T7V8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 92344
• Name: Human GORAB (aa 80-157) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI467484; dynactin 1, isoform 1; dynactin 1 (p150, Glued homolog); p150, Glued homolog; 150 kDa dynein-associated polypeptide; p150-glued; GO; golgin, RAB6 interacting; golgin, RAB6-interacting; Gorab; hNTKL-BP1; mNTKL-BP1; N-terminal kinase-like-binding protein 1; NTKL-binding protein 1; NTKLBP1; NTKL-BP1; RAB6-interacting golgin; RAB6-interacting golgin-like protein; SCY1-like 1 binding protein 1; SCY1-like 1-binding protein 1; SCYL1-binding protein 1; Scyl1bp1; SCYL1-BP1
• Common Name: GORAB
• Gene Symbol: Gorab
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENSHDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQQEQRLME
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining