Invitrogen™ Human GPI (aa 323-412) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91942	100 μL

Catalog No. RP91942 Supplier Invitrogen™ Supplier No. RP91942

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82874. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene belongs to the GPI family whose members encode multifunctional phosphoglucose isomerase proteins involved in energy pathways. The protein encoded by this gene is a dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. The protein functions in different capacities inside and outside the cell. In the cytoplasm, the gene product is involved in glycolysis and gluconeogenesis, while outside the cell it functions as a neurotrophic factor for spinal and sensory neurons. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment.

Specifications

• Accession Number: P06744
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2821
• Name: Human GPI (aa 323-412) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Amf; Autocrine motility factor; glucose phosphate isomerase; glucose phosphate isomerase 1; glucose phosphate isomerase 1 complex; glucose phosphate isomerase 1, regulatory; glucose phosphate isomerase 1, structural; glucose phosphate isomerase 1, temporal; glucose-6-phosphate isomerase; glucose-6-phosphate isomerase {ECO:0000250; GNPI; Gpi; GPI {ECO:0000250; gpi {ECO:0000312; GPI1; Gpi-1; Gpi-1r; Gpi1-r; Gpi1s; Gpi-1s; Gpi1-s; Gpi-1t; Gpi1-t; GPI-GlcNAc transferase complex subunit GPI1; hexose monophosphate isomerase; hexosephosphate isomerase; maturation factor; MF; Neuroleukin; neuroleukin {ECO:0000250; NK; NK/GPI; Nlk; NLK {ECO:0000250; Org; oxoisomerase; PGI; PGI {ECO:0000250; Phi; PHI {ECO:0000250; phosphatidylinositol N-acetylglucosaminyltransferase; Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI1; Phosphoglucose isomerase; phosphoglucose isomerase {ECO:0000250; phosphohexomutase; phosphohexose isomerase; phosphohexose isomerase {ECO:0000250; phosphosaccharomutase; RGD:2727}; SA36; SA-36; sperm antigen; sperm antigen 36; sperm antigen-36; UniProtKB:P06745}; YGR216C
• Common Name: GPI
• Gene Symbol: GPI
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining