Invitrogen™ Human GPLD1 (aa 256-367) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102400	100 μL

Catalog No. RP102400 Supplier Invitrogen™ Supplier No. RP102400

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52941. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GPLD1 is expressed in numerous tissues and cells and specifically cleaves GPI-anchored proteins. Liver has the highest level of GPI-PLD expression and is the primary organ contributing to GPLD1 in the serum. GPLD1 is abundant in serum in which it associates with polipoproteins AI and AIV. Increased serum GPLD1 is associated with insulin resistance and elevated serum triglycerides. Many surface proteins are attached to eukaryotic cell membranes via glycosylphosphatidylinositol (GPI) anchors that are covalently bound to the C-terminus of the protein and cleavage of the GPI moiety by GPLD1, only enzyme known that cleavage GPI anchor, may represent a means of regulating attachment of these proteins to the cell surface, or alternatively, their release into the extracellular environment.

Specifications

• Accession Number: P80108
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2822
• Name: Human GPLD1 (aa 256-367) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 6330541J12Rik; AW546131; glycoprotein phospholipase D; glycosylphosphatidylinositol phospholipase D; glycosylphosphatidylinositol specific phospholipase D1; glycosylphosphatidylinositol specific phospholipase D1, isoform 2; Glycosyl-phosphatidylinositol-specific phospholipase D; GPIPLD; GPI-PLD; GPIPLDM; GPI-specific phospholipase D; Gpld1; MGC22590; Phosphatidylinositol-glycan-specific phospholipase D; PI-G PLD; PIGPLD; PIGPLD1; PLD
• Common Name: GPLD1
• Gene Symbol: GPLD1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FWSTNIYHLTSFMLENGTSDCNLPENPLFIACGGQQNHTQGSKMQKNDFHRNLTTSLTESVDRNINYTERGVFFSVNSWTPDSMSFIYKALERNIRTMFIGGSQLSQKHVSS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining