Invitrogen™ Human GPR115 (aa 37-180) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89574	100 μL

Catalog No. RP89574 Supplier Invitrogen™ Supplier No. RP89574

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82284. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. GPCR GPR115 is a member of this family (subfamily Orphan-B). ESTs have been isolated from breast, heart, and placenta libraries.

Specifications

• Accession Number: Q8IZF3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 221393
• Name: Human GPR115 (aa 37-180) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4632435A09Rik; ADGRF4; Adhesion G protein-coupled receptor F4; AV239010; FLJ38076; G protein-coupled receptor 115; GPR115; G-protein coupled receptor 115; G-protein coupled receptor PGR18; PGR18; probable G-protein coupled receptor 115; RGD1565216; seven transmembrane helix receptor
• Common Name: GPR115
• Gene Symbol: ADGRF4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QSPEGKPKTGRIQEKCEGPCISSSNCSQPCAKDFHGEIGFTCNQKKWQKSAETCTSLSVEKLFKDSTGASRLSVAAPSIPLHILDFRAPETIESVAQGIRKNCPFDYACITDMVKSSETTSGNIAFIVELLKNISTDLSDNVTR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining